PTM Viewer PTM Viewer

AT1G50060.1

Arabidopsis thaliana [ath]

CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein

No PTMs currently found

PLAZA: AT1G50060
Gene Family: HOM05D000217
Other Names: NULL

Link out to other resources with this protein ID : TAIR   |   PeptideAtlas   |   ARAPORT   |   PhosPhAt

PTMs

There are no stored PTMs for this protein

Sequence

Length: 161

MNTFKTPFLVIVAISFLVVATNAQNTPQDYLNSHNTARAQVGVPNVVWDTTLAAYALNYSNFRKADCNLVHSNGPYGENLAKGSSSSFSAISAVKLWVDEKPYYSYAYNNCTGGKQCLHYTQVVWRDSVKIGCARVQCTNTWWFVSCNYNSPGNWVGEYPY

Domains & Sites

Clear highlighted range 
Interpro Domains
Show IPR ID From To
IPR014044 25 157
Molecule Processing
Show Type From To
Signal Peptide 1 23

BLAST


Perform a BLAST search for this sequence, or a part of this sequence (minimum 50 characters)
A downloadable tutorial can be found here